Product Description
Recombinant Human Antigen-presenting glycoprotein CD1d (CD1D), partial is available at Gentaur for Next week Delivery.
Gene Name: CD1D
Alternative Names : R3G1; CD1d
Expression Region : 20-301aa
AA Sequence : EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTS
Sequence Info : Extracellular Domain
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 47.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Antigen-presenting protein that binds self and non-self glycolipids and presents th to T-cell receptors on natural killer T-cells.
Function : Antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells.
Involvement in disease :
Subcellular location : Cell membrane, Single-pass type I membrane protein, Basolateral cell membrane, Single-pass type I membrane protein, Endosome membrane, Single-pass type I membrane protein, Lysosome membrane, Single-pass type I membrane protein, Endoplasmic reticulum membrane, Single-pass type I membrane protein
Protein Families :
Tissue Specificity : Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
Paythway : Hematopoieticcelllineage
Uniprot ID : P15813
Euro
British Pound
US Dollar