Recombinant Human Antigen-presenting glycoprotein CD1d (CD1D), partial

Product Description

Recombinant Human Antigen-presenting glycoprotein CD1d (CD1D), partial is available at Gentaur for Next week Delivery.

Gene Name: CD1D

Alternative Names : R3G1; CD1d

Expression Region : 20-301aa

AA Sequence : EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTS

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 47.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Antigen-presenting protein that binds self and non-self glycolipids and presents th to T-cell receptors on natural killer T-cells.

Function : Antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells.

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type I membrane protein, Basolateral cell membrane, Single-pass type I membrane protein, Endosome membrane, Single-pass type I membrane protein, Lysosome membrane, Single-pass type I membrane protein, Endoplasmic reticulum membrane, Single-pass type I membrane protein

Protein Families :

Tissue Specificity : Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.

Paythway : Hematopoieticcelllineage

Uniprot ID : P15813