Recombinant Human AP-1 complex subunit sigma-3 (AP1S3)

Product Description

Recombinant Human AP-1 complex subunit sigma-3 (AP1S3) is available at Gentaur for Next week Delivery.

Gene Name: AP1S3

Alternative Names : Adaptor protein complex AP-1 subunit sigma-1C;Adaptor-related protein complex 1 subunit sigma-1C;Clathrin assembly protein complex 1 sigma-1C small chain;Golgi adaptor HA1/AP1 adaptin sigma-1C subunit;Sigma 1C subunit of AP-1 clathrin;Sigma-adaptin 1C;Sigma1C-adaptin

Expression Region : 1-104aa

AA Sequence : MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA

Sequence Info : Full Length of Isoform 3

Tag Info : N-terminal GST-tagged

Theoretical MW : 39.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to mbranes and the recognition of sorting signals within the cytosolic tails of transmbrane cargo molecules. Involved in TLR3 trafficking .

Function : Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Involved in TLR3 trafficking

Involvement in disease : Psoriasis 15, pustular (PSORS15)

Subcellular location : Golgi apparatus, Cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Membrane, clathrin-coated pit

Protein Families : Adaptor complexes small subunit family

Tissue Specificity : Widely expressed.

Paythway :

Uniprot ID : Q96PC3