Recombinant Human Apolipoprotein C-III (APOC3)

Product Description

Recombinant Human Apolipoprotein C-III (APOC3) is available at Gentaur for Next week Delivery.

Gene Name: APOC3

Alternative Names : Apolipoprotein C3

Expression Region : 21-99aa

AA Sequence : SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 24.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assbly and secretion; Extracellular domainly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by rnant receptors.

Function : Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma

Involvement in disease : Hyperalphalipoproteinemia 2 (HALP2)

Subcellular location : Secreted

Protein Families : Apolipoprotein C3 family

Tissue Specificity : Liver.

Paythway : PPARsignalingpathway

Uniprot ID : P02656