Product Description
Recombinant Human Apolipoprotein C-III (APOC3) is available at Gentaur for Next week Delivery.
Gene Name: APOC3
Alternative Names : Apolipoprotein C3
Expression Region : 21-99aa
AA Sequence : SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 24.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Metabolism
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assbly and secretion; Extracellular domainly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by rnant receptors.
Function : Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma
Involvement in disease : Hyperalphalipoproteinemia 2 (HALP2)
Subcellular location : Secreted
Protein Families : Apolipoprotein C3 family
Tissue Specificity : Liver.
Paythway : PPARsignalingpathway
Uniprot ID : P02656
 Euro
 Euro
             British Pound
 British Pound
             US Dollar
 US Dollar
             
             
                 
       
           
           
           
           
          