Recombinant Human Apoptosis facilitator Bcl-2-like protein 14 (BCL2L14)

Product Description

Recombinant Human Apoptosis facilitator Bcl-2-like protein 14 (BCL2L14) is available at Gentaur for Next week Delivery.

Gene Name: BCL2L14

Alternative Names : Apoptosis regulator Bcl-G

Expression Region : 1-327aa

AA Sequence : MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 63.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays a role in apoptosis.

Function : Plays a role in apoptosis.

Involvement in disease :

Subcellular location : Cytoplasm, SUBCELLULAR LOCATION: Isoform 1: Cytoplasm, cytosol, Note=Diffusely distributed throughout the cytosol, SUBCELLULAR LOCATION: Isoform 2: Endomembrane system

Protein Families : Bcl-2 family

Tissue Specificity : Isoform 1 is widely expressed. Isoform 2 is testis-specific.

Paythway :

Uniprot ID : Q9BZR8