Euro
British Pound
US Dollar
Product Description
Recombinant Human Arylsulfatase B (ARSB) is available at Gentaur for Next week Delivery.
Gene Name: ARSB
Alternative Names : N-acetylgalactosamine-4-sulfatase;G4S
Expression Region : 37-533aa
AA Sequence : SGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 58 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Roves sulfate groups from chondroitin-4-sulfate (C4S) and regulates its degradation . Involved in the regulation of cell adhesion, cell migration and invasion in colonic epithelium . In the central nervous syst, is a regulator of neurite outgrowth and neuronal plasticity, acting through the control of sulfate glycosaminoglycans and neurocan levels .
Function : Removes sulfate groups from chondroitin-4-sulfate (C4S) and regulates its degradation
Involvement in disease : Mucopolysaccharidosis 6 (MPS6); Multiple sulfatase deficiency (MSD)
Subcellular location : Lysosome, Cell surface
Protein Families : Sulfatase family
Tissue Specificity :
Paythway :
Uniprot ID : P15848
