Product Description
Recombinant Human Aspartyl/asparaginyl beta-hydroxylase (ASPH), partial is available at Gentaur for Next week Delivery.
Gene Name: ASPH
Alternative Names : Aspartate beta-hydroxylase;ASP beta-hydroxylase;Peptide-aspartate beta-dioxygenase
Expression Region : 75-270aa
AA Sequence : FDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT
Sequence Info : Partial of Isoform 6
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 38.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Isoform 1: specifically hydroxylates an Asp or Asn residue in certain epidermal growth factor-like (EGF) domains of a number of proteins.
Function : Isoform 1
Involvement in disease : Facial dysmorphism, lens dislocation, anterior segment abnormalities, and spontaneous filtering blebs (FDLAB)
Subcellular location : Isoform 1: Endoplasmic reticulum membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 4: Sarcoplasmic reticulum membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 8: Endoplasmic reticulum membrane, Single-pass type II membrane protein
Protein Families : Aspartyl/asparaginyl beta-hydroxylase family
Tissue Specificity : Isoform 1 is detected in all tissues tested. Isoform 8 is mainly expressed in pancreas, heart, brain, kidney and liver. Isoform 8 is expressed in kidney (at protein level).
Paythway :
Uniprot ID : Q12797
Euro
British Pound
US Dollar