Recombinant Human Aspartyl/asparaginyl beta-hydroxylase (ASPH), partial

Product Description

Recombinant Human Aspartyl/asparaginyl beta-hydroxylase (ASPH), partial is available at Gentaur for Next week Delivery.

Gene Name: ASPH

Alternative Names : Aspartate beta-hydroxylase;ASP beta-hydroxylase;Peptide-aspartate beta-dioxygenase

Expression Region : 75-270aa

AA Sequence : FDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT

Sequence Info : Partial of Isoform 6

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 38.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Isoform 1: specifically hydroxylates an Asp or Asn residue in certain epidermal growth factor-like (EGF) domains of a number of proteins.

Function : Isoform 1

Involvement in disease : Facial dysmorphism, lens dislocation, anterior segment abnormalities, and spontaneous filtering blebs (FDLAB)

Subcellular location : Isoform 1: Endoplasmic reticulum membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 4: Sarcoplasmic reticulum membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 8: Endoplasmic reticulum membrane, Single-pass type II membrane protein

Protein Families : Aspartyl/asparaginyl beta-hydroxylase family

Tissue Specificity : Isoform 1 is detected in all tissues tested. Isoform 8 is mainly expressed in pancreas, heart, brain, kidney and liver. Isoform 8 is expressed in kidney (at protein level).

Paythway :

Uniprot ID : Q12797