Recombinant Human B9 domain-containing protein 2 (B9D2)

Product Description

Recombinant Human B9 domain-containing protein 2 (B9D2) is available at Gentaur for Next week Delivery.

Gene Name: B9D2

Alternative Names : MKS1-related protein 2

Expression Region : 1-175aa

AA Sequence : MAEVHVIGQIIGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYGVEC

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 46.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes.

Function : Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes.

Involvement in disease : Meckel syndrome 10 (MKS10)

Subcellular location : Cytoplasm, cytoskeleton, cilium basal body, Cytoplasm, cytoskeleton, cilium axoneme, Nucleus

Protein Families : B9D family

Tissue Specificity :

Paythway :

Uniprot ID : Q9BPU9