Recombinant Human BEN domain-containing protein 3 (BEND3), partial

Product Description

Recombinant Human BEN domain-containing protein 3 (BEND3), partial is available at Gentaur for Next week Delivery.

Gene Name: BEND3

Alternative Names :

Expression Region : 328-461aa

AA Sequence : CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 17.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function : Transcriptional repressor which associates with the NoRC (nucleolar remodeling complex) complex and plays a key role in repressing rDNA transcription. The sumoylated form modulates the stability of the NoRC complex component BAZ2A/TIP5 by controlling its USP21-mediated deubiquitination

Involvement in disease :

Subcellular location : Nucleus, Nucleus, nucleolus

Protein Families :

Tissue Specificity : Expressed at least in heart, kidney, liver, ovary and spleen, with highest levels in spleen and lowest in heart. Expressed on the surface of T-cells.

Paythway :

Uniprot ID : Q5T5X7