Recombinant Human Beta-crystallin S (CRYGS

Product Description

Recombinant Human Beta-crystallin S (CRYGS is available at Gentaur for Next week Delivery.

Gene Name: CRYGS

Alternative Names : Gamma-S-crystallin Gamma-crystallin S

Expression Region : 2-178aa

AA Sequence : SKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal GST-tagged

Theoretical MW : 47.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Crystallins are the dominant structural components of the vertebrate eye lens.

Function : Crystallins are the dominant structural components of the vertebrate eye lens.

Involvement in disease : Cataract 20, multiple types (CTRCT20)

Subcellular location :

Protein Families : Beta/gamma-crystallin family

Tissue Specificity :

Paythway :

Uniprot ID : P22914