Recombinant Human Beta-galactoside alpha-2,6-sialyltransferase 1 (ST6GAL1)

Product Description

Recombinant Human Beta-galactoside alpha-2,6-sialyltransferase 1 (ST6GAL1) is available at Gentaur for Next week Delivery.

Gene Name: ST6GAL1

Alternative Names : B-cell antigen CD75 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1 ST6Gal I

Expression Region : 1-406aa

AA Sequence : MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 52.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Transfers sialic acid from CMP-sialic acid to galactose-containing acceptor substrates.

Function : Transfers sialic acid from CMP-sialic acid to galactose-containing acceptor substrates.

Involvement in disease :

Subcellular location : Golgi apparatus, Golgi stack membrane, Single-pass type II membrane protein, Secreted

Protein Families : Glycosyltransferase 29 family

Tissue Specificity :

Paythway :

Uniprot ID : P15907