Recombinant Human Biliverdin reductase A (BLVRA)

Product Description

Recombinant Human Biliverdin reductase A (BLVRA) is available at Gentaur for Next week Delivery.

Gene Name: BLVRA

Alternative Names : Biliverdin-IX alpha-reductase

Expression Region : 1-296aa

AA Sequence : MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 60.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Reduces the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor.

Function : Reduces the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor.

Involvement in disease : Hyperbiliverdinemia (HBLVD)

Subcellular location : Cytoplasm

Protein Families : Gfo/Idh/MocA family, Biliverdin reductase subfamily

Tissue Specificity : Liver.

Paythway :

Uniprot ID : P53004