Recombinant Human BolA-like protein 1 (BOLA1)

Product Description

Recombinant Human BolA-like protein 1 (BOLA1) is available at Gentaur for Next week Delivery.

Gene Name: BOLA1

Alternative Names : hBolA

Expression Region : 1-137aa

AA Sequence : MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 16.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function : Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins (By similarity). Probably acts together with the monothiol glutaredoxin GLRX5

Involvement in disease :

Subcellular location : Mitochondrion

Protein Families : BolA/IbaG family

Tissue Specificity : Widely expressed.

Paythway :

Uniprot ID : Q9Y3E2