Recombinant Human Butyrophilin subfamily 3 member A2 (BTN3A2), partial

Product Description

Recombinant Human Butyrophilin subfamily 3 member A2 (BTN3A2), partial is available at Gentaur for Next week Delivery.

Gene Name: BTN3A2

Alternative Names :

Expression Region : 30-248aa

AA Sequence : QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 25.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells.

Function : Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells.

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type I membrane protein

Protein Families : Immunoglobulin superfamily, BTN/MOG family

Tissue Specificity : Detected in T-cells and natural killer cells.

Paythway :

Uniprot ID : P78410