Recombinant Human C-C motif chemokine 20 (CCL20), partial

Product Description

Recombinant Human C-C motif chemokine 20 (CCL20), partial is available at Gentaur for Next week Delivery.

Gene Name: CCL20

Alternative Names : Beta-chemokine exodus-1CC chemokine LAR;CLiver and activation-regulated chemokine;Macrophage inflammatory protein 3 alpha;MIP-3-alpha;Small-inducible cytokine A20

Expression Region : 27-95aa

AA Sequence : ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKN

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 34.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Chotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Inhibits proliferation of myeloid progenitors in colony formation assays. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells. C-terminal processed forms have been shown to be equally chotactically active for leukocytes. Possesses antibacterial activity E.coli ATCC 25922 and S.aureus ATCC 29213.

Function : Acts as a ligand for C-C chemokine receptor CCR6. Signals through binding and activation of CCR6 and induces a strong chemotactic response and mobilization of intracellular calcium ions

Involvement in disease :

Subcellular location : Secreted

Protein Families : Intercrine beta (chemokine CC) family

Tissue Specificity : Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level). Expressed predominantly in the liver, lymph nodes, appendix, peripheral blood lymphocytes, and fetal lung. Low levels seen in thymus, prostate, testis, small intestine and colon.

Paythway : Chemokinesignalingpathway

Uniprot ID : P78556