Recombinant Human C-Myc-binding protein (MYCBP)

Product Description

Recombinant Human C-Myc-binding protein (MYCBP) is available at Gentaur for Next week Delivery.

Gene Name: MYCBP

Alternative Names : Associate of Myc 1;AMY-1

Expression Region : 2-103aa

AA Sequence : AHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 27.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.

Function : May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus, Mitochondrion

Protein Families : AMY1 family

Tissue Specificity : Highly expressed in heart, placenta, pancreas, skeletal muscle and kidney. Also present at low levels in lung.

Paythway :

Uniprot ID : Q99417