Product Description
Recombinant Human C-Myc-binding protein (MYCBP) is available at Gentaur for Next week Delivery.
Gene Name: MYCBP
Alternative Names : Associate of Myc 1;AMY-1
Expression Region : 2-103aa
AA Sequence : AHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 27.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.
Function : May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.
Involvement in disease :
Subcellular location : Cytoplasm, Nucleus, Mitochondrion
Protein Families : AMY1 family
Tissue Specificity : Highly expressed in heart, placenta, pancreas, skeletal muscle and kidney. Also present at low levels in lung.
Paythway :
Uniprot ID : Q99417
Euro
British Pound
US Dollar