Recombinant Human C-type lectin domain family 4 member C (CLEC4C),parial (Active)

Product Description

Recombinant Human C-type lectin domain family 4 member C (CLEC4C),parial (Active) is available at Gentaur for Next week Delivery.

Gene Name: CLEC4C

Alternative Names : Blood dendritic cell antigen 2;BDCA-2;C-type lectin superfamily member 7Dendritic lectin; CD303

Expression Region : 45-213aa

AA Sequence : NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 36 kDa

Storage Buffer : Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0

Endotoxin Level : Not tested-

Biological Activity : Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 ?g/ml can bind human IgG, the EC50 of human IgG is 31.43-43.52 ?g/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not se to bind mannose.

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q8WTT0