Euro
British Pound
US Dollar
Product Description
Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial is available at Gentaur for Next week Delivery.
Gene Name: CLEC4C
Alternative Names : Blood dendritic cell antigen 2 Short name: BDCA-2 C-type lectin superfamily member 7 Dendritic lectin CD_antigen: CD303
Expression Region : 45-213aa
AA Sequence : NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Sequence Info : Extracellular Domain
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 22 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not seem to bind mannose.
Function : Lectin-type cell surface receptor which may play a role in antigen capturing by dendritic cells
Involvement in disease :
Subcellular location : Cell membrane, Single-pass type II membrane protein
Protein Families :
Tissue Specificity : Expressed in plasmacytoid dendritic cells (PDCs). Constitutively expressed in immature monocyte-derived dendritic cells (iMDDC) and is significantly down-regulated upon maturation with LPS but not with TNF-alpha.
Paythway :
Uniprot ID : Q8WTT0
