Recombinant Human C-X-C motif chemokine 10 (CXCL10)

Product Description

Recombinant Human C-X-C motif chemokine 10 (CXCL10) is available at Gentaur for Next week Delivery.

Gene Name: CXCL10

Alternative Names : 10KDA interferon gamma-induced protein;Gamma-IP10;IP-10Small-inducible cytokine B10

Expression Region : 22-98aa

AA Sequence : VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 10.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Chotactic for monocytes and T-lymphocytes. Binds to CXCR3.

Function : Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Intercrine alpha (chemokine CxC) family

Tissue Specificity :

Paythway : Chemokinesignalingpathway

Uniprot ID : P02778