Recombinant Human C-X-C motif chemokine 14(CXCL14) (Active)

Product Description

Recombinant Human C-X-C motif chemokine 14(CXCL14) (Active) is available at Gentaur for Next week Delivery.

Gene Name: CXCL14

Alternative Names : C-X-C Motif Chemokine 14; Chemokine BRAKm MIP-2G; Small-Inducible Cytokine B14; CXCL14; MIP2G; NJAC; SCYB14

Expression Region : 35-111aa

AA Sequence : SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 9.4 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 1 M NaCl, pH 8.5

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to induce calcium flux of prostaglandin E2 treated THP1 human acute monocytic leukemia cells is typically 1-10 ng/mL.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Human Chemokine (C-X-C Motif) Ligand 14 (CXCL14) is constitutively expressed in certain normal tissues but is reduced or absent from many established tumor cell lines and human cancers. CXCL14 is known to be a chemoattractant for monocyte and dendritic cells. CXCL14 inhibits angiogenesis and exhibits antimicrobial activities. Mature human and mouse CXCL14 differ by only 2 amino acid residues.

Function : Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Intercrine alpha (chemokine CxC) family

Tissue Specificity : Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derived dendritic cells. Not detected in lung or unstimulated peripheral blood lymphocytes.

Paythway : Chemokinesignalingpathway

Uniprot ID : O95715