Recombinant Human C-X-C motif chemokine 5 (CXCL5), partial

Product Description

Recombinant Human C-X-C motif chemokine 5 (CXCL5), partial is available at Gentaur for Next week Delivery.

Gene Name: CXCL5

Alternative Names : ENA-78(1-78)Epithelial-derived neutrophil-activating protein 78Neutrophil-activating peptide ENA-78Small-inducible cytokine B5

Expression Region : 37-110aa

AA Sequence : AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 11.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chotactic activity for neutrophil granulocytes.

Function : Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Intercrine alpha (chemokine CxC) family

Tissue Specificity :

Paythway : Chemokinesignalingpathway

Uniprot ID : P42830