Recombinant Human Calmodulin-like protein 5 (CALML5)

Product Description

Recombinant Human Calmodulin-like protein 5 (CALML5) is available at Gentaur for Next week Delivery.

Gene Name: CALML5

Alternative Names : Calmodulin-like skin protein

Expression Region : 2-146aa

AA Sequence : AGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 31.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds calcium. May be involved in terminal differentiation of keratinocytes.

Function : Binds calcium. May be involved in terminal differentiation of keratinocytes.

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity : Particularly abundant in the epidermis where its expression is directly related to keratinocyte differentiation. Very low expression in lung.

Paythway : Calciumsignalingpathway

Uniprot ID : Q9NZT1