Product Description
Recombinant Human Cancer/testis antigen 1 (CTAG1A) is available at Gentaur for Next week Delivery.
Gene Name: CTAG1A
Alternative Names : Autoimmunogenic cancer/testis antigen NY-ESO-1 Cancer/testis antigen 6.1
Expression Region : 1-180aa
AA Sequence : MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Sequence Info : Full Length
Tag Info : N-terminal 10xHis-tagged
Theoretical MW : 21.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : CTAG/PCC1 family
Tissue Specificity : Expressed in testis and ovary and in a wide variety of cancers. Detected in uterine myometrium. Expressed from 18 weeks until birth in human fetal testis. In the adult testis, is strongly expressed in spermatogonia and in primary spermatocytes, but not in post-meiotic cells or in testicular somatic cells (at protein level).
Paythway :
Uniprot ID : P78358
Euro
British Pound
US Dollar