Recombinant Human Cancer/testis antigen 1 (CTAG1A)

Product Description

Recombinant Human Cancer/testis antigen 1 (CTAG1A) is available at Gentaur for Next week Delivery.

Gene Name: CTAG1A

Alternative Names : Autoimmunogenic cancer/testis antigen NY-ESO-1 Cancer/testis antigen 6.1

Expression Region : 1-180aa

AA Sequence : MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-tagged

Theoretical MW : 21.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : CTAG/PCC1 family

Tissue Specificity : Expressed in testis and ovary and in a wide variety of cancers. Detected in uterine myometrium. Expressed from 18 weeks until birth in human fetal testis. In the adult testis, is strongly expressed in spermatogonia and in primary spermatocytes, but not in post-meiotic cells or in testicular somatic cells (at protein level).

Paythway :

Uniprot ID : P78358