Euro
British Pound
US Dollar
Product Description
Recombinant Human Cancer/testis antigen 2 (CTAG2) is available at Gentaur for Next week Delivery.
Gene Name: CTAG2
Alternative Names : Autoimmunogenic cancer/testis antigen NY-ESO-2 Cancer/testis antigen 6.2 Short name: CT6.2 L antigen family member 1 Short name: LAGE-1 ESO2, LAGE1
Expression Region : 1-210aa
AA Sequence : MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-sumostar-tagged
Theoretical MW : 37.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location :
Protein Families : CTAG/PCC1 family
Tissue Specificity : Testis and very low level in placenta and in some uterus samples. Observed in 25-50% of tumor samples of melanomas, non-small-cell lung carcinomas, bladder, prostate and head and neck cancers.
Paythway :
Uniprot ID : O75638
