Recombinant Human Carbonic anhydrase 1 (CA1)

Product Description

Recombinant Human Carbonic anhydrase 1 (CA1) is available at Gentaur for Next week Delivery.

Gene Name: CA1

Alternative Names : Carbonate dehydratase ICarbonic anhydrase B;CABCarbonic anhydrase I;CA-I

Expression Region : 2-261aa

AA Sequence : ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 30.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.

Function : Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Alpha-carbonic anhydrase family

Tissue Specificity :

Paythway :

Uniprot ID : P00915