Recombinant Human CCAAT/enhancer-binding protein gamma (CEBPG)

Product Description

Recombinant Human CCAAT/enhancer-binding protein gamma (CEBPG) is available at Gentaur for Next week Delivery.

Gene Name: CEBPG

Alternative Names :

Expression Region : 1-150aa

AA Sequence : MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 43.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Transcription factor that binds to the promoter and the enhancer regions of target genes. Binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene. Binds to the promoter and the enhancer of the immunoglobulin heavy chain. Binds to GPE1, a cis-acting element in the G-CSF gene promoter.

Function : Transcription factor that binds to the promoter and the enhancer regions of target genes. Binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene

Involvement in disease :

Subcellular location : Nucleus

Protein Families : BZIP family, C/EBP subfamily

Tissue Specificity :

Paythway :

Uniprot ID : P53567