Recombinant Human Chromodomain-helicase-DNA-binding protein 4 (CHD4), partial

Product Description

Recombinant Human Chromodomain-helicase-DNA-binding protein 4 (CHD4), partial is available at Gentaur for Next week Delivery.

Gene Name: CHD4

Alternative Names : ATP-dependent helicase CHD4Mi-2 autoantigen 218KDA protein;Mi2-beta

Expression Region : 1-239aa

AA Sequence : MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVES

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Theoretical MW : 31.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Component of the histone deacetylase NuRD complex which participates in the rodeling of chromatin by deacetylating histones.

Function : Component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin by deacetylating histones.

Involvement in disease : Sifrim-Hitz-Weiss syndrome (SIHIWES)

Subcellular location : Nucleus, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome

Protein Families : SNF2/RAD54 helicase family

Tissue Specificity :

Paythway :

Uniprot ID : Q14839