Recombinant Human Chromogranin-A (CHGA), partial

Product Description

Recombinant Human Chromogranin-A (CHGA), partial is available at Gentaur for Next week Delivery.

Gene Name: CHGA

Alternative Names : Pituitary secretory protein I;SP-I

Expression Region : 224-457aa

AA Sequence : QAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 53.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Pancreastatin: Strongly inhibits glucose induced insulin release from the pancreas.Catestatin: Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic antagonist . Displays antibacterial activity against Gram-positive bacteria S.aureus and M.luteus, and Gram-negative bacteria E.coli and P.aeruginosa . Can induce mast cell migration, degranulation and production of cytokines and chokines . Acts as a potent scavenger of free radicals in vitro . May play a role in the regulation of cardiac function and blood pressure .

Function : Pancreastatin

Involvement in disease :

Subcellular location : Cytoplasmic vesicle, secretory vesicle lumen, Cytoplasmic vesicle, secretory vesicle membrane, Secreted, Note=Associated with the secretory granule membrane through direct interaction to SCG3 that in turn binds to cholesterol-enriched lipid rafts in intragranular conditions, SUBCELLULAR LOCATION: Serpinin: Secreted, Cytoplasmic vesicle, secretory vesicle

Protein Families : Chromogranin/secretogranin protein family

Tissue Specificity : GE-25 is found in the brain.

Paythway :

Uniprot ID : P10645