Recombinant Human Coagulation factor V (F5), partial

Product Description

Recombinant Human Coagulation factor V (F5), partial is available at Gentaur for Next week Delivery.

Gene Name: F5

Alternative Names : Activated protein C cofactorProaccelerin, labile factor

Expression Region : 1490-1614aa

AA Sequence : MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTT

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 30.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Central regulator of hostasis. It serves as a critical cofactor for the prothrombinase activity of factor Xa that results in the activation of prothrombin to thrombin.

Function : Central regulator of hemostasis. It serves as a critical cofactor for the prothrombinase activity of factor Xa that results in the activation of prothrombin to thrombin.

Involvement in disease : Factor V deficiency (FA5D); Thrombophilia due to activated protein C resistance (THPH2); Budd-Chiari syndrome (BDCHS); Ischemic stroke (ISCHSTR); Pregnancy loss, recurrent, 1 (RPRGL1)

Subcellular location : Secreted

Protein Families : Multicopper oxidase family

Tissue Specificity : Plasma.

Paythway : Complementandcoagulationcascades

Uniprot ID : P12259