Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial

Product Description

Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial is available at Gentaur for Next week Delivery.

Gene Name: COL18A1

Alternative Names :

Expression Region : 1578-1754aa

AA Sequence : QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 21.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Adhesion

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : COLA18A probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.Endostatin potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling.

Function : Probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.

Involvement in disease : Knobloch syndrome 1 (KNO1)

Subcellular location : Secreted, extracellular space, extracellular matrix, Secreted, extracellular space, extracellular matrix, basement membrane, SUBCELLULAR LOCATION: Non-collagenous domain 1: Secreted, extracellular space, extracellular matrix, basement membrane, Secreted, SUBCELLULAR LOCATION: Endostatin: Secreted, Secreted, extracellular space, extracellular matrix, basement membrane

Protein Families : Multiplexin collagen family

Tissue Specificity : Present in multiple organs with highest levels in liver, lung and kidney.

Paythway :

Uniprot ID : P39060