Recombinant Human coronavirus OC43 Spike glycoprotein (S), partial

Product Description

Recombinant Human coronavirus OC43 Spike glycoprotein (S), partial is available at Gentaur for Next week Delivery.

Gene Name: S

Alternative Names : E2;Peplomer protein

Expression Region : 15-344aa

AA Sequence : VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 39.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : S1 attaches the virion to the cell mbrane by interacting with sialic acid-containing cell receptors, initiating the infection.S2 is a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell mbrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell mbranes.

Function : S1 attaches the virion to the cell membrane by interacting with sialic acid-containing cell receptors, initiating the infection.; FUNCTION

Involvement in disease :

Subcellular location : Spike protein S2: Virion membrane, Single-pass type I membrane protein, Host endoplasmic reticulum-Golgi intermediate compartment membrane, Single-pass type I membrane protein, Note=Accumulates in the endoplasmic reticulum-Golgi intermediate compartment, where it participates in virus particle assembly, Some S oligomers may be transported to the plasma membrane, where they may mediate cell-cell fusion (By similarity), SUBCELLULAR LOCATION: Spike protein S1: Virion membrane, Peripheral membrane protein, Host endoplasmic reticulum-Golgi intermediate compartment membrane, Peripheral membrane protein

Protein Families : Betacoronaviruses spike protein family

Tissue Specificity :

Paythway :

Uniprot ID : P36334