Product Description
Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 1 (HSD11B1), partial is available at Gentaur for Next week Delivery.
Gene Name: HSD11B1
Alternative Names : 11-beta-hydroxysteroid dehydrogenase 1;11-DH;11-beta-HSD1Short chain dehydrogenase/reductase family 26C member 1
Expression Region : 25-292aa
AA Sequence : EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 45.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol .
Function : Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol (By similarity).
Involvement in disease : Cortisone reductase deficiency 2 (CORTRD2)
Subcellular location : Endoplasmic reticulum membrane, Single-pass type II membrane protein
Protein Families : Short-chain dehydrogenases/reductases (SDR) family
Tissue Specificity : Widely expressed. Highest expression in liver.
Paythway :
Uniprot ID : P28845
Euro
British Pound
US Dollar