Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 1 (HSD11B1), partial

Product Description

Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 1 (HSD11B1), partial is available at Gentaur for Next week Delivery.

Gene Name: HSD11B1

Alternative Names : 11-beta-hydroxysteroid dehydrogenase 1;11-DH;11-beta-HSD1Short chain dehydrogenase/reductase family 26C member 1

Expression Region : 25-292aa

AA Sequence : EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 45.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol .

Function : Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol (By similarity).

Involvement in disease : Cortisone reductase deficiency 2 (CORTRD2)

Subcellular location : Endoplasmic reticulum membrane, Single-pass type II membrane protein

Protein Families : Short-chain dehydrogenases/reductases (SDR) family

Tissue Specificity : Widely expressed. Highest expression in liver.

Paythway :

Uniprot ID : P28845