Product Description
Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 2 (HSD11B2) is available at Gentaur for Next week Delivery.
Gene Name: HSD11B2
Alternative Names : 11-beta-hydroxysteroid dehydrogenase type 2;11-DH2;11-beta-HSD211-beta-hydroxysteroid dehydrogenase type II;-HSD11 type IINAD-dependent 11-beta-hydroxysteroid dehydrogenase;11-beta-HSDShort chain dehydrogenase/reductase family 9C member 3
Expression Region : 1-405aa
AA Sequence : MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 46.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
Function : Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
Involvement in disease : Apparent mineralocorticoid excess (AME)
Subcellular location : Microsome, Endoplasmic reticulum
Protein Families : Short-chain dehydrogenases/reductases (SDR) family
Tissue Specificity : Expressed in kidney, pancreas, prostate, ovary, small intestine and colon. At midgestation, expressed at high levels in placenta and in fetal kidney and, at much lower levels, in fetal lung and testis (PubMed:8530071).
Paythway :
Uniprot ID : P80365
Euro
British Pound
US Dollar