Recombinant Human Corticotropin-releasing factor receptor 1 (CRHR1), partial

Product Description

Recombinant Human Corticotropin-releasing factor receptor 1 (CRHR1), partial is available at Gentaur for Next week Delivery.

Gene Name: CRHR1

Alternative Names : Corticotropin-releasing hormone receptor 1;CRH-R-1;CRH-R1

Expression Region : 23-121aa

AA Sequence : ASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 13 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal bryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.

Function : G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal embryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein, Endosome

Protein Families : G-protein coupled receptor 2 family

Tissue Specificity : Predominantly expressed in the cerebellum, pituitary, cerebral cortex and olfactory lobe.

Paythway :

Uniprot ID : P34998