Recombinant Human CXXC-type zinc finger protein 4 (CXXC4)

Product Description

Recombinant Human CXXC-type zinc finger protein 4 (CXXC4) is available at Gentaur for Next week Delivery.

Gene Name: CXXC4

Alternative Names : Inhibition of the Dvl and axin complex protein

Expression Region : 1-198aa

AA Sequence : MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSSSGGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGTSLERTPVPSAEAFRWFF

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 48 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Acts as a negative regulator of the Wnt signaling pathway via its interaction with DVL1

Function : Acts as a negative regulator of the Wnt signaling pathway via its interaction with DVL1.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q9H2H0