Recombinant Human Cysteine and glycine-rich protein 2 (CSRP2)

Product Description

Recombinant Human Cysteine and glycine-rich protein 2 (CSRP2) is available at Gentaur for Next week Delivery.

Gene Name: CSRP2

Alternative Names : Cysteine-rich protein 2;CRP2LIM domain only protein 5;LMO-5Smooth muscle cell LIM protein;SmLIM

Expression Region : 2-193aa

AA Sequence : PVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 24.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Developmental Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. Ses to play a role in the development of the bryonic vascular syst.

Function : Drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. Seems to play a role in the development of the embryonic vascular system.

Involvement in disease :

Subcellular location : Nucleus

Protein Families :

Tissue Specificity : Highly expressed in the aorta, but not in heart and skeletal muscle.

Paythway :

Uniprot ID : Q16527