Product Description
Recombinant Human Cytochrome b-c1 complex subunit 9 (UQCR10) is available at Gentaur for Next week Delivery.
Gene Name: UQCR10
Alternative Names : Complex III subunit 9 Complex III subunit X Cytochrome c1 non-heme 7KDA protein Ubiquinol-cytochrome c reductase complex 7.2KDA protein
Expression Region : 1-63aa
AA Sequence : AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 34.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Tags & Cell Markers
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1
Function : This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1 (By similarity).
Involvement in disease :
Subcellular location : Mitochondrion inner membrane
Protein Families : UQCR10/QCR9 family
Tissue Specificity :
Paythway : Cardiacmusclecontraction
Uniprot ID : Q9UDW1
Euro
British Pound
US Dollar