Recombinant Human Cytochrome b-c1 complex subunit 9 (UQCR10)

Product Description

Recombinant Human Cytochrome b-c1 complex subunit 9 (UQCR10) is available at Gentaur for Next week Delivery.

Gene Name: UQCR10

Alternative Names : Complex III subunit 9 Complex III subunit X Cytochrome c1 non-heme 7KDA protein Ubiquinol-cytochrome c reductase complex 7.2KDA protein

Expression Region : 1-63aa

AA Sequence : AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 34.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Tags & Cell Markers

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1

Function : This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1 (By similarity).

Involvement in disease :

Subcellular location : Mitochondrion inner membrane

Protein Families : UQCR10/QCR9 family

Tissue Specificity :

Paythway : Cardiacmusclecontraction

Uniprot ID : Q9UDW1