Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1)

Product Description

Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1) is available at Gentaur for Next week Delivery.

Gene Name: COX4I1

Alternative Names : Cytochrome c oxidase polypeptide IVCytochrome c oxidase subunit IV isoform 1;COX IV-1

Expression Region : 23-169aa

AA Sequence : AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 33.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Function : This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Involvement in disease :

Subcellular location : Mitochondrion inner membrane

Protein Families : Cytochrome c oxidase IV family

Tissue Specificity : Ubiquitous.

Paythway : Cardiacmusclecontraction

Uniprot ID : P13073