Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial (COX5A)

Product Description

Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial (COX5A) is available at Gentaur for Next week Delivery.

Gene Name: COX5A

Alternative Names : Cytochrome c oxidase polypeptide Va

Expression Region : 42-150aa

AA Sequence : SHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal GST-tagged

Theoretical MW : 39.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This is the he A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Function : This is the heme A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Involvement in disease : Mitochondrial complex IV deficiency is a rare condition caused by mutation in COX5A that lead to pulmonary arterial hypertension (PAH), failure to thrive and lactic acidemia.

Subcellular location : Mitochondrion inner membrane

Protein Families : Cytochrome c oxidase subunit 5A family

Tissue Specificity :

Paythway : Cardiacmusclecontraction

Uniprot ID : P20674