Product Description
Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial (COX5A) is available at Gentaur for Next week Delivery.
Gene Name: COX5A
Alternative Names : Cytochrome c oxidase polypeptide Va
Expression Region : 42-150aa
AA Sequence : SHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal GST-tagged
Theoretical MW : 39.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Metabolism
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : This is the he A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Function : This is the heme A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Involvement in disease : Mitochondrial complex IV deficiency is a rare condition caused by mutation in COX5A that lead to pulmonary arterial hypertension (PAH), failure to thrive and lactic acidemia.
Subcellular location : Mitochondrion inner membrane
Protein Families : Cytochrome c oxidase subunit 5A family
Tissue Specificity :
Paythway : Cardiacmusclecontraction
Uniprot ID : P20674
 Euro
            
 British Pound
            
 US Dollar