Product Description
Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4), partial is available at Gentaur for Next week Delivery.
Gene Name: CTLA4
Alternative Names : Cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4) (CD_antigen: CD152) (CD152)
Expression Region : 37-162aa
AA Sequence : AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 17.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
Function :
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P16410
Euro
British Pound
US Dollar