Recombinant Human D-3-phosphoglycerate dehydrogenase (PHGDH), partial

Product Description

Recombinant Human D-3-phosphoglycerate dehydrogenase (PHGDH), partial is available at Gentaur for Next week Delivery.

Gene Name: PHGDH

Alternative Names :

Expression Region : 2-251aa

AA Sequence : AFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQS

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 53.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function : Catalyzes the reversible oxidation of 3-phospho-D-glycerate to 3-phosphonooxypyruvate, the first step of the phosphorylated L-serine biosynthesis pathway. Also catalyzes the reversible oxidation of 2-hydroxyglutarate to 2-oxoglutarate and the reversible oxidation of (S)-malate to oxaloacetate.

Involvement in disease : Phosphoglycerate dehydrogenase deficiency (PHGDHD); Neu-Laxova syndrome 1 (NLS1)

Subcellular location :

Protein Families : D-isomer specific 2-hydroxyacid dehydrogenase family

Tissue Specificity :

Paythway :

Uniprot ID : O43175