Recombinant Human D-amino acid oxidase activator (DAOA)

Product Description

Recombinant Human D-amino acid oxidase activator (DAOA) is available at Gentaur for Next week Delivery.

Gene Name: DAOA

Alternative Names : Protein G72

Expression Region : 1-153aa

AA Sequence : MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEGWKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQSCNHKEITSTKAE

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 45.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Ses to activate D-amino acid oxidase.

Function : Seems to activate D-amino acid oxidase.

Involvement in disease : Schizophrenia (SCZD)

Subcellular location : Golgi apparatus

Protein Families :

Tissue Specificity : Expressed in amygdala, caudate nucleus, spinal cord and testis.

Paythway :

Uniprot ID : P59103