Euro
British Pound
US Dollar
Product Description
Recombinant Human Diamine acetyltransferase 1 (SAT1), partial is available at Gentaur for Next week Delivery.
Gene Name: SAT1
Alternative Names : Polyamine N-acetyltransferase 1;Putrescine acetyltransferase;Spermidine/spermine N(1)-acetyltransferase 1;SSAT;SSAT-1
Expression Region : 5-171aa
AA Sequence : VIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 23.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Metabolism
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine = spermidine >> spermine > N(1)-acetylspermine > putrescine. This highly regulated enzyme allows a fine attenuation of the intracellular concentration of polyamines. Also involved in the regulation of polyamine transport out of cells. Acts on 1,3-diaminopropane, 1,5-diaminopentane, putrescine, spermidine (forming N(1)- and N(8)-acetylspermidine), spermine, N(1)-acetylspermidine and N(8)-acetylspermidine.
Function : Enzyme which catalyzes the acetylation of polyamines. Substrate specificity
Involvement in disease : Keratosis follicularis spinulosa decalvans X-linked (KFSDX)
Subcellular location : Cytoplasm
Protein Families : Acetyltransferase family
Tissue Specificity :
Paythway :
Uniprot ID : P21673
